PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g18270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB_related
Protein Properties Length: 117aa    MW: 12717.8 Da    PI: 8.4933
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g18270genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.62.1e-111445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     +g+WT+eEd +lv +++++G+g+W++++   g
       CA10g18270 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTG 45
                     79*************************98877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-13543IPR009057Homeodomain-like
SuperFamilySSF466891.08E-9844IPR009057Homeodomain-like
PROSITE profilePS5129411.982961IPR017930Myb domain
PfamPF002491.4E-91445IPR001005SANT/Myb domain
CDDcd001674.11E-71646No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MGRPPCCDKI GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGNLVQI LNLKFVFNFF  60
CFPSGIGIWA QLKFMSGSPR RLLVKAEGVV LITPPGVPSN KGDSLSYPGL EIETFG*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755225e-58HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1548477
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.21e-29myb domain protein 96